…o democracies.3 Militants have no regard for human rights; they have their own “code of conduct” and seek to destroy the very structures and institutions that form the basis of democratic life. Militants often view democracies as “soft,” usually on the grounds that “their publics…

…ts the low social position is that the mudûm appearing beside the ubārum in the code does surely not belong to the social elite, leastways in Ugarit, as researchers had previously thought.33 If we, therefore return to Ugarit, it can be rendered probable on the basis of these para…

…ed textons and scriptons, in game for instance, whether they are in ASCII or Unicode, also contain configurative aspects from which the indexical relationship is constructed via game mechanics. Through this game mechanics, the expectation the designers have on benefactive relatio…

…htlich publiziert wurde. 310 109 Die Knopfsicheln werden mit einem zweiteiligen Code beschrieben. Der erste Teil besteht von der kodierten Beschreibung der Form der Griffbasis und der Position des Knopfes. Der zweite Teil ist eine eventuelle Ergänzung für die Kodierung der Rippen…

…17th ) Currency Philippine peso ( ₱ ) ( PHP ) Time zone UTC +8 ( PhST ) Calling code +63 ISO 3166 code PH Internet TLD .ph The Philippines , [ f ] officially the Republic of the Philippines , [ g ] is an archipelagic country in Southeast Asia . Located in the western Pacific Ocea…

…ce with military power; (2) decisively shaped the new constitution and/or legal code; (3) assumed executive or legislative powers; (4) decisively shaped economic policies; and (5) participated in executive policing.15 He then evaluated the success of each mission in preventing re…

…hich the Plan is based: 1. including adaptation measures in the City’s Building Code - with aim to envisage clear and explicit incentives for adapting the built environment to more efficient management solutions of climate change effects; WIT Transactions on Ecology and The Envir…

…habitants de la province), ressort aussi d'un décret émis par l'empereur Zénon (Codex Justinianus, 1, 3, 35(36) concernant, entre autres, «la situation des très saintes églises se trouvant sous la protection de la ville de Tomis», qui (( ne devaient pas être soumises à la contrai…

…apply to air and marine transport of laboratory materials. Safety standards and codes are created by nongovernmental bodies, but are important to know because they may be required by a law (by reference), as condition of occupancy, by an insurance company, by an accrediting body,…

UNLOCODE (US) - UNITED STATES OF AMERICA (THE) United Nations Code for Trade and Transport Locations (UN/LOCODE) (US) UNITED STATES OF AMERICA (THE) Ch LOCODE Name NameWoDiacritics SubDiv Function Status Date IATA Coordinates Remarks US OQU Aaron Aaron GA --3----- RL 1407 3234N 0…

…-relay dev-python/makefun dev-python/nbclient dev-python/nbconvert dev-python/opcodes dev-python/openapi-core dev-python/pandas dev-python/passlib dev-python/paste dev-python/pbs-installer dev-python/pdm dev-python/pyatspi dev-python/pycurl dev-python/pylast dev-python/pyperclip …

…ty_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide (L)' no no ;VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKV…

…gen.plasmid_name pET30a _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PANC_MYCTU _struct_ref.pdbx_db_accession P0A5R0 _struct_ref.entity_id 1 _struct_ref.biol_id . _struct_ref.pdbx_seq_one_letter_code ;MTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGS VV…

…ategories are provided to describe polymeric entities. Polymer type, one-letter code polymer sequences, sequence length, information about non-standard linkages and chirality may be specified. In the _entity_poly.pdbx_seq_one_letter_code sequence, modified residues are identified…

…ategories are provided to describe polymeric entities. Polymer type, one-letter code polymer sequences, sequence length, information about non-standard linkages and chirality may be specified. In the _entity_poly.pdbx_seq_one_letter_code sequence, modified residues are identified…