…o democracies.3 Militants have no regard for human rights; they have their own “code of conduct” and seek to destroy the very structures and institutions that form the basis of democratic life. Militants often view democracies as “soft,” usually on the grounds that “their publics…
…ce with military power; (2) decisively shaped the new constitution and/or legal code; (3) assumed executive or legislative powers; (4) decisively shaped economic policies; and (5) participated in executive policing.15 He then evaluated the success of each mission in preventing re…
…hich the Plan is based: 1. including adaptation measures in the City’s Building Code - with aim to envisage clear and explicit incentives for adapting the built environment to more efficient management solutions of climate change effects; WIT Transactions on Ecology and The Envir…
…habitants de la province), ressort aussi d'un décret émis par l'empereur Zénon (Codex Justinianus, 1, 3, 35(36) concernant, entre autres, «la situation des très saintes églises se trouvant sous la protection de la ville de Tomis», qui (( ne devaient pas être soumises à la contrai…
…apply to air and marine transport of laboratory materials. Safety standards and codes are created by nongovernmental bodies, but are important to know because they may be required by a law (by reference), as condition of occupancy, by an insurance company, by an accrediting body,…
UNLOCODE (US) - UNITED STATES OF AMERICA (THE) United Nations Code for Trade and Transport Locations (UN/LOCODE) (US) UNITED STATES OF AMERICA (THE) Ch LOCODE Name NameWoDiacritics SubDiv Function Status Date IATA Coordinates Remarks US OQU Aaron Aaron GA --3----- RL 1407 3234N 0…
…-relay dev-python/makefun dev-python/nbclient dev-python/nbconvert dev-python/opcodes dev-python/openapi-core dev-python/pandas dev-python/passlib dev-python/paste dev-python/pbs-installer dev-python/pdm dev-python/pyatspi dev-python/pycurl dev-python/pylast dev-python/pyperclip …
…ty_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide (L)' no no ;VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKV…
…gen.plasmid_name pET30a _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PANC_MYCTU _struct_ref.pdbx_db_accession P0A5R0 _struct_ref.entity_id 1 _struct_ref.biol_id . _struct_ref.pdbx_seq_one_letter_code ;MTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGS VV…
…ategories are provided to describe polymeric entities. Polymer type, one-letter code polymer sequences, sequence length, information about non-standard linkages and chirality may be specified. In the _entity_poly.pdbx_seq_one_letter_code sequence, modified residues are identified…
…ategories are provided to describe polymeric entities. Polymer type, one-letter code polymer sequences, sequence length, information about non-standard linkages and chirality may be specified. In the _entity_poly.pdbx_seq_one_letter_code sequence, modified residues are identified…
…made available between formal releases of OpenBSD. These are builds of whatever code is in the tree at the time. A recent snapshot is usually all you need to run -current. If you wish to build it from source, starting from the latest snapshot is required. Check the following -cur…
…ys keep a photocopy for your own records. A Note on Fair Use The U.S. Copyright Code is purposefully vague regarding the concept of fair use. Legally, fair use is based on the cumulative consideration of 4 factors as per Section 107 of the U.S Copyright Code. Due to the vague nat…
…I + Add _refine_ls_restr.pdbx_Zscore + Updated examples in _database_2.database_code + Add gemmi to _software.name PDBx enumeration + Add 'M' to _em_software.name enumeration. mmcif_pdbx.dic 5.402 2025-01-28 Changes (ep): + Add _em_motion_correction category. + Add _em_imaging.ob…
…I + Add _refine_ls_restr.pdbx_Zscore + Updated examples in _database_2.database_code + Add gemmi to _software.name PDBx enumeration + Add 'M' to _em_software.name enumeration. mmcif_pdbx.dic 5.410 2025-01-28 Changes (ep): + Add _em_motion_correction category. + Add _em_imaging.ob…
Page 1
Next →