Nápověda k MediaWiki API
Toto je automaticky generovaná dokumentační stránka k MediaWiki API.
Dokumentace a příklady: https://www.mediawiki.org/wiki/Special:MyLanguage/API:Main_page
Hlavní modul
- Zdroj: MediaWiki
- Licence: GPL-2.0-or-later
Stav: Všechny funkce uvedené na této stránce by měly fungovat, ale API se stále aktivně vyvíjí a může se kdykoli změnit. Upozornění na změny získáte přihlášením se k e-mailové konferenci mediawiki-api-announce.
Chybné požadavky: Pokud jsou do API zaslány chybné požadavky, bude vrácena HTTP hlavička s klíčem „MediaWiki-API-Error“ a hodnota této hlavičky a chybový kód budou nastaveny na stejnou hodnotu. Více informací najdete v dokumentaci.
Testování: Pro jednoduché testování požadavků na API zkuste Special:ApiSandbox.
- action
Která akce se má provést.
- abusefiltercheckmatch
- Check to see if an AbuseFilter matches a set of variables, an edit, or a logged AbuseFilter event.
- abusefilterchecksyntax
- Zkontroluje syntaxi filtru zneužití.
- abusefilterevalexpression
- Vyhodnotí výraz filtru zneužití.
- abusefilterunblockautopromote
- Unblocks a user from receiving autopromotions due to an abusefilter consequence.
- abuselogprivatedetails
- Zobrazit tajné detaily záznamu v protokolu zneužití
- acquiretempusername
- Acquire a temporary user username and stash it in the current session, if temp account creation is enabled and the current user is logged out. If a name has already been stashed, returns the same name.
- antispoof
- Check a username against AntiSpoof's normalisation checks.
- block
- Zablokovat uživatele.
- centralauthtoken
- Fetch a centralauthtoken for making an authenticated request to an attached wiki.
- centralnoticecdncacheupdatebanner
- Request the purge of banner content stored in the CDN (front-end) cache for anonymous users, for the requested banner and language
- centralnoticechoicedata
- Get data needed to choose a banner for a given project and language
- centralnoticequerycampaign
- Get all configuration settings for a campaign.
- changeauthenticationdata
- Change authentication data for the current user.
- changecontentmodel
- Change the content model of a page
- checktoken
- Check the validity of a token from action=query&meta=tokens.
- clearhasmsg
- Clears the
hasmsgflag for the current user. - clientlogin
- Log in to the wiki using the interactive flow.
- communityconfigurationedit
- Change the content of a configuration provider in Community configuration
- compare
- Vrátí rozdíl dvou stránek.
- createaccount
- Vytvořit nový uživatelský účet.
- createlocalaccount
- Forcibly create a local account. The central account must exist.
- cxdelete
- Smazat koncept překladů vytvořený pomocí rozšíření Překlad Obsahu.
- cxtoken
- Získejte JWT žetony pro ověřování pomocí cxserveru.
- delete
- Smazat stránku.
- deleteglobalaccount
- Delete a global user.
- discussiontoolsedit
- Zveřejnit zprávu na diskusní stránce.
- discussiontoolsfindcomment
- Find a comment by its ID or name.
- discussiontoolsgetsubscriptions
- Získat stavy odběru daných témat.
- discussiontoolssubscribe
- Přihlášení (nebo odhlášení) příjmu oznámení o tématu.
- discussiontoolsthank
- Send a public thank-you notification for a comment.
- echocreateevent
- Manually trigger a notification to a user
- echomarkread
- Mark notifications as read for the current user.
- echomarkseen
- Mark notifications as seen for the current user.
- echomute
- Mute or unmute notifications from certain users or pages.
- edit
- Vytvářet a upravovat stránky.
- editmassmessagelist
- Edit a mass message delivery list.
- emailuser
- Poslat uživateli e-mail.
- expandtemplates
- Rozbalí všechny šablony ve wikitextu.
- featuredfeed
- Returns a featured content feed.
- feedcontributions
- Vrátí kanál příspěvků uživatele.
- feedrecentchanges
- Returns a recent changes feed.
- feedwatchlist
- Returns a watchlist feed.
- filerevert
- Revertovat soubor na starší verzi.
- flow
- Allows actions to be taken on Structured Discussions pages.
- flow-parsoid-utils
- Convert text between wikitext and HTML.
- flowthank
- Send a public thank-you notification for a Flow comment.
- globalblock
- Globally block or unblock a user.
- globalpreferenceoverrides
- Change local overrides for global preferences for the current user.
- globalpreferences
- Change global preferences of the current user.
- globaluserrights
- Add/remove a user to/from global groups.
- growthmanagementorlist
- Spravovat informace ve strukturovaném seznamu mentorů (obvykle uložené na stránce MediaWiki:GrowthMentors.json). Tento modul mohou používat jak současní, tak budoucí mentoři (aby se přidali nebo změnili informace o sobě). Modul mohou použít také správci, kteří mohou změnit informace o všech uživatelích.
- growthmentordashboardupdatedata
- Naplánovat mimořádnou aktualizaci modulu "Vaši nováčci". Z výkonnostních důvodů můžete naplánovat maximálně jednu aktualizaci každé dvě hodiny.
- growthsetmenteestatus
- Nastavit stav nováčka (dovoluje uživateli vypnout/zapnout modul mentorství, anebo se zcela z mentorského programu vyvázat, což smaže vztah mezi mentorem a mentorovaným).
- growthsetmentor
- Nastavit mentora uživatele. Změna bude veřejně zaznamenána.
- growthstarmentee
- Nastavit nováčka jako označeného hvězdičkou (uloženo soukromě a nelogováno)
- help
- Zobrazuje nápovědu k uvedeným modulům.
- homepagequestionstore
- Obtain formatted questions posted via homepage modules
- imagerotate
- Tento modul byl deaktivován.
- import
- Import a page from another wiki, or from an XML file.
- jsonconfig
- Allows direct access to JsonConfig subsystem.
- languagesearch
- Search for language names in any script.
- linkaccount
- Link an account from a third-party provider to the current user.
- login
- Log in and get authentication cookies.
- logout
- Log out and clear session data.
- managetags
- Perform management tasks relating to change tags.
- massmessage
- Send a message to a list of pages.
- mergehistory
- Merge page histories.
- move
- Přesunout stránku.
- opensearch
- Vyhledávání na wiki pomocí protokolu OpenSearch.
- options
- Change preferences of the current user.
- paraminfo
- Obtain information about API modules.
- parse
- Parses content and returns parser output.
- patrol
- Patrol a page or revision.
- protect
- Změnit úroveň zamčení stránky.
- purge
- Purge the cache for the given titles.
- query
- Fetch data from and about MediaWiki.
- removeauthenticationdata
- Remove authentication data for the current user.
- resetpassword
- Send a password reset email to a user.
- revisiondelete
- Delete and undelete revisions.
- rollback
- Undo the last edit to the page.
- rsd
- Export an RSD (Really Simple Discovery) schema.
- setglobalaccountstatus
- Nastavit stav globálního účtu
- setnotificationtimestamp
- Update the notification timestamp for watched pages.
- setpagelanguage
- Change the language of a page.
- shortenurl
- Zkrátit dlouhé URL na kratší.
- sitematrix
- Get Wikimedia sites list.
- spamblacklist
- Validate one or more URLs against the spam block list.
- streamconfigs
- Exposes event stream config. Returns only format=json with formatversion=2.
- strikevote
- Allows admins to strike or unstrike a vote.
- sxdelete
- Delete the draft section translation and its parallel corpora from database.
- tag
- Add or remove change tags from individual revisions or log entries.
- templatedata
- Fetch data stored by the TemplateData extension.
- thank
- Send a thank-you notification to an editor.
- titleblacklist
- Ověřit název stránky, název souboru nebo uživatelské jméno vůči černé listině názvů.
- torblock
- Check if an IP address is blocked as a Tor exit node.
- transcodereset
- Users with the 'transcode-reset' right can reset and re-run a transcode job.
- unblock
- Unblock a user.
- undelete
- Undelete revisions of a deleted page.
- unlinkaccount
- Remove a linked third-party account from the current user.
- upload
- Upload a file, or get the status of pending uploads.
- userrights
- Change a user's group membership.
- validatepassword
- Validate a password against the wiki's password policies.
- watch
- Add or remove pages from the current user's watchlist.
- webapp-manifest
- Returns a webapp manifest.
- webauthn
- API Module to communicate between server and client during registration/authentication process.
- bouncehandler
- Internal. Receive a bounce email and process it to handle the failing recipient.
- categorytree
- Internal. Internal module for the CategoryTree extension.
- chartinfo
- Internal. Retrieve current count of how many unique Chart page usages there are. Multiple uses of the same chart on the same page are considered a single use.
- cirrus-check-sanity
- Internal. Reports on the correctness of a range of page ids in the search index
- cirrus-config-dump
- Internal. Dump of CirrusSearch configuration.
- cirrus-profiles-dump
- Internal. Dump of CirrusSearch profiles for this wiki.
- cirrus-schema-dump
- Internal. Dump of CirrusSearch schema (settings and mappings) for this wiki.
- codemirror-validate
- Internal. Check for validation errors in the given content
- collection
- Internal. API module for performing various operations on a wiki user's collection.
- cspreport
- Internal. Used by browsers to report violations of the Content Security Policy. This module should never be used, except when used automatically by a CSP compliant web browser.
- cxcheckunreviewed
- Internal. Check if any fast, unreviewed translation has been published recently for the current user.
- cxfavoritesuggestions
- Internal. Add or remove a favorite suggestion to the current user's list.
- cxpublish
- Internal. Uložit stránku vytvořenou pomocí rozšíření Překlad Obsahu.
- cxpublishsection
- Internal. Save a section created using the Content Translation extension's section translation feature.
- cxsave
- Internal. Tento modul vám umožňuje ukládat návrhy překladu podle jednotlivých částí, abyste ušetřili šířku pásma a vytvořili paralelní korpus.
- cxsplit
- Internal. Create and save a section translation to database, for every translated section of the given article translation
- discussiontoolscompare
- Internal. Získat informace o změnách komentářů mezi dvěma revizemi stránky.
- discussiontoolspageinfo
- Internal. Vrací metadata potřebná k inicializaci Diskusních nástrojů.
- discussiontoolspreview
- Internal. Náhled zprávy na stránce diskuse.
- echopushsubscriptions
- Internal. Manage push subscriptions for the current user.
- editcheckreferenceurl
- Internal. Check the status of a URL for use as a reference.
- fancycaptchareload
- Internal. Get a new FancyCaptcha.
- growthinvalidateimagerecommendation
- Internal. Zneplatnit návrh obrázku.
- growthinvalidatepersonalizedpraisesuggestion
- Internal. Zneplatní návrh nováčka k ocenění v modulu Zašlete ocenění svým nováčkům na Nástěnce mentora
- growthinvalidaterevisetonerecommendation
- Internal. Drop a 'Revise Tone' recommendation for a given page.
- helppanelquestionposter
- Internal. Handle questions posted via the help panel for the current user.
- jsondata
- Internal. Retrieve localized JSON data.
- jsontransform
- Internal. Retrieve JSON data transformed by a Lua function.
- parser-migration
- Internal. Analyzuje stránku pomocí dvou odlišných konfigurací Tidy.
- readinglists
- Internal. Reading list write operations.
- sanitize-mapdata
- Internal. Performs data validation for Kartographer extension
- scribunto-console
- Internal. Internal module for servicing XHR requests from the Scribunto console.
- securepollauth
- Internal. Allows a remote wiki to authenticate users before granting access to vote in the election.
- stashedit
- Internal. Prepare an edit in shared cache.
- sxsave
- Internal. Save the draft section translation and store the parallel corpora
- timedtext
- Internal. Provides timed text content for usage by <track> elements
- ulslocalization
- Internal. Get the localization of ULS in the given language.
- ulssetlang
- Internal. Update user's preferred interface language.
- visualeditor
- Internal. Returns HTML5 for a page from the Parsoid service.
- visualeditoredit
- Internal. Save an HTML5 page to MediaWiki (converted to wikitext via the Parsoid service).
- wikimediaeventsblockededit
- Internal. Log information about blocked edit attempts
- wikimediaeventshcaptchaeditattempt
- Internal. Log edit diff when hCaptcha challenge is shown but edit is incomplete
- Jedna z následujících hodnot: abusefiltercheckmatch, abusefilterchecksyntax, abusefilterevalexpression, abusefilterunblockautopromote, abuselogprivatedetails, acquiretempusername, antispoof, block, centralauthtoken, centralnoticecdncacheupdatebanner, centralnoticechoicedata, centralnoticequerycampaign, changeauthenticationdata, changecontentmodel, checktoken, clearhasmsg, clientlogin, communityconfigurationedit, compare, createaccount, createlocalaccount, cxdelete, cxtoken, delete, deleteglobalaccount, discussiontoolsedit, discussiontoolsfindcomment, discussiontoolsgetsubscriptions, discussiontoolssubscribe, discussiontoolsthank, echocreateevent, echomarkread, echomarkseen, echomute, edit, editmassmessagelist, emailuser, expandtemplates, featuredfeed, feedcontributions, feedrecentchanges, feedwatchlist, filerevert, flow-parsoid-utils, flow, flowthank, globalblock, globalpreferenceoverrides, globalpreferences, globaluserrights, growthmanagementorlist, growthmentordashboardupdatedata, growthsetmenteestatus, growthsetmentor, growthstarmentee, help, homepagequestionstore, imagerotate, import, jsonconfig, languagesearch, linkaccount, login, logout, managetags, massmessage, mergehistory, move, opensearch, options, paraminfo, parse, patrol, protect, purge, query, removeauthenticationdata, resetpassword, revisiondelete, rollback, rsd, setglobalaccountstatus, setnotificationtimestamp, setpagelanguage, shortenurl, sitematrix, spamblacklist, streamconfigs, strikevote, sxdelete, tag, templatedata, thank, titleblacklist, torblock, transcodereset, unblock, undelete, unlinkaccount, upload, userrights, validatepassword, watch, webapp-manifest, webauthn, bouncehandler, categorytree, chartinfo, cirrus-check-sanity, cirrus-config-dump, cirrus-profiles-dump, cirrus-schema-dump, codemirror-validate, collection, cspreport, cxcheckunreviewed, cxfavoritesuggestions, cxpublish, cxpublishsection, cxsave, cxsplit, discussiontoolscompare, discussiontoolspageinfo, discussiontoolspreview, echopushsubscriptions, editcheckreferenceurl, fancycaptchareload, growthinvalidateimagerecommendation, growthinvalidatepersonalizedpraisesuggestion, growthinvalidaterevisetonerecommendation, helppanelquestionposter, jsondata, jsontransform, parser-migration, readinglists, sanitize-mapdata, scribunto-console, securepollauth, stashedit, sxsave, timedtext, ulslocalization, ulssetlang, visualeditor, visualeditoredit, wikimediaeventsblockededit, wikimediaeventshcaptchaeditattempt
- Default: help
- format
Formát výstupu.
- json
- Vypisuje data ve formátu JSON.
- jsonfm
- Vypisuje data ve formátu JSON (v čitelné HTML podobě).
- none
- Nevypisuje nic.
- php
- Vypisuje data v serializačním formátu PHP.
- phpfm
- Vypisuje data v serializačním formátu PHP (v čitelné HTML podobě).
- rawfm
- Data včetně ladicích prvků vypisuje ve formátu JSON (v čitelné HTML podobě).
- xml
- Vypisuje data ve formátu XML.
- xmlfm
- Vypisuje data ve formátu XML (v čitelné HTML podobě).
- Jedna z následujících hodnot: json, jsonfm, none, php, phpfm, rawfm, xml, xmlfm
- Default: jsonfm
- maxlag
Maximální zpoždění lze použít, když je MediaWiki nainstalováno na cluster s replikovanou databází. Abyste se vyhnuli zhoršování už tak špatného replikačního zpoždění, můžete tímto parametrem nechat klienta čekat, dokud replikační zpoždění neklesne pod uvedenou hodnotu. V případě příliš vysokého zpoždění se vrátí chybový kód „maxlag“ s hlášením typu „Waiting for $host: $lag seconds lagged“.
Více informací najdete v příručce.- Type: integer
- smaxage
Nastaví HTTP hlavičku pro řízení kešování
s-maxagena uvedený počet sekund. Chyby se nekešují nikdy.- Type: integer
- The value must be no less than 0.
- Default: 0
- maxage
Nastaví HTTP hlavičku pro řízení kešování
max-agena uvedený počet sekund. Chyby se nekešují nikdy.- Type: integer
- The value must be no less than 0.
- Default: 0
- assert
Pokud je nastaveno na „user“, ověří, že je uživatel přihlášen, pokud je nastaveno na „bot“, ověří, že má oprávnění „bot“.
- Jedna z následujících hodnot: anon, bot, user
- assertuser
Ověřit, že současným uživatelem je uvedený uživatel.
- Typ: uživatel, uvedený jako cokoli z: uživatelské jméno a Dočasný uživatel
- requestid
Libovolná zde uvedená hodnota bude zahrnuta v odpovědi. Lze použít pro rozlišení požadavků.
- servedby
Zahrnout do odpovědi název hostitele, který požadavek obsloužil.
- Type: boolean (details)
- curtimestamp
Zahrnout do odpovědi aktuální časové razítko.
- Type: boolean (details)
- responselanginfo
Include the languages used for uselang and errorlang in the result.
- Type: boolean (details)
- origin
Pokud k API přistupujete pomocí mezidoménového AJAXového požadavku (CORS), nastavte tento parametr na doménu původu. Musí být součástí všech předběžných požadavků, takže musí být součástí URI požadavku (nikoli těla POSTu).
U autentizovaných požadavků hodnota musí přesně odpovídat jednomu z původů v hlavičce
Origin, takže musí být nastavena na něco jako https://en.wikipedia.org nebo https://meta.wikimedia.org. Pokud parametr neodpovídá hlavičceOrigin, bude vrácena odpověď 403. Pokud parametr odpovídá hlavičceOrigina tento původ je na bílé listině, budou nastaveny hlavičkyAccess-Control-Allow-OriginaAccess-Control-Allow-Credentials.U neautentizovaných požadavků uveďte hodnotu *. To způsobí nastavení hlavičky
Access-Control-Allow-Origin, ale hlavičkaAccess-Control-Allow-Credentialsbudefalsea budou omezena všechna data specifická pro uživatele.- crossorigin
When accessing the API using a cross-domain AJAX request (CORS) and using a session provider that is safe against cross-site request forgery (CSRF) attacks (such as OAuth), use this instead of
origin=*to make the request authenticated (i.e., not logged out). This must be included in any pre-flight request, and therefore must be part of the request URI (not the POST body).Note that most session providers, including standard cookie-based sessions, do not support authenticated CORS and cannot be used with this parameter.
- Type: boolean (details)
- uselang
Jazyk, který se má použít pro překlad hlášení. Pomocí action=query&meta=siteinfo se siprop=languages získáte seznam jazykových kódů nebo zadejte „user“ pro použití předvoleného jazyka aktuálního uživatele či „content“ pro použití jazyka obsahu této wiki.
- Default: user
- variant
Variant of the language. Only works if the base language supports variant conversion.
- errorformat
Format to use for warning and error text output
- plaintext
- Wikitext with HTML tags removed and entities replaced.
- wikitext
- Unparsed wikitext.
- html
- HTML
- raw
- Message key and parameters.
- none
- No text output, only the error codes.
- bc
- Format used prior to MediaWiki 1.29. errorlang and errorsuselocal are ignored.
- Jedna z následujících hodnot: bc, html, none, plaintext, raw, wikitext
- Default: bc
- errorlang
Language to use for warnings and errors. action=query&meta=siteinfo&siprop=languages returns a list of language codes. Specify content to use this wiki's content language or uselang to use the same value as the uselang parameter.
- Default: uselang
- errorsuselocal
If given, error texts will use locally-customized messages from the MediaWiki namespace.
- Type: boolean (details)
- centralauthtoken
Tento token používejte při přístupu k API pomocí mezidoménového AJAX požadavku (CORS) pro autentizaci jako aktuální uživatel SUL. Před provedením CORS requestu získejte na této wiki token pomocí action=centralauthtoken. Každý token lze použít pouze jednou a expiruje po 10 sekundách. Měl by se použít v případném předběžném požadavku, takže by se měl objevit v URI požadavku (nikoli tělu POST).
On this wiki the expected value is a JSON Web Token, which may be validated by proxy servers in front of MediaWiki. If the token has expired or is otherwise invalid, you may receive a HTTP error from a proxy in a different format than a normal API error.
- Nápověda k hlavnímu modulu
- api.php?action=help [otevřít v pískovišti]
- Veškerá nápověda na jedné stránce
- api.php?action=help&recursivesubmodules=1 [otevřít v pískovišti]
Datové typy
Input to MediaWiki should be NFC-normalized UTF-8. MediaWiki may attempt to convert other input, but this may cause some operations (such as edits with MD5 checks) to fail.
Parameters that take multiple values are normally submitted with the values separated using the pipe character, e.g. param=value1|value2 or param=value1%7Cvalue2. If a value must contain the pipe character, use U+001F (Unit Separator) as the separator and prefix the value with U+001F, e.g. param=%1Fvalue1%1Fvalue2.
Some parameter types in API requests need further explanation:
- boolean
Boolean parameters work like HTML checkboxes: if the parameter is specified, regardless of value, it is considered true. For a false value, omit the parameter entirely.
- expiry
Expiry values may be relative (e.g. 5 months or 2 weeks) or absolute (e.g. 2014-09-18T12:34:56Z). For no expiry, use infinite, indefinite, infinity or never.
- timestamp
Timestamps may be specified in several formats, see the Timestamp library input formats documented on mediawiki.org for details. ISO 8601 date and time is recommended: 2001-01-15T14:56:00Z. Additionally, the string now may be used to specify the current timestamp.
Šablonované parametry
Šablonované parametry umožňují situace, kdy modul API potřebuje hodnotu pro každou hodnotu nějakého jiného parametru. Pokud by například existoval modul API pro získání ovoce, mohl by mít parametr ovoce, kterým se určí požadované druhy ovoce, a šablonovaný parametr {ovoce}-počet, kterým se určí požadované počty jednotlivých druhů. Klient API, který by chtěl 1 jablko, 5 banánů a 20 jahod, by mohl vytvořit požadavek ovoce=jablka|banány|jahody&jablka-počet=1&banány-počet=5&jahody-počet=20.
Zásluhy
Vývojáři API:
- Jurij Astrachan (tvůrce, hlavní vývojář září 2006 – září 2007)
- Roan Kattouw (hlavní vývojář září 2007–2009)
- Viktor Vasiljev
- Bryan Tong Minh
- Sam Reed
- Brad Jorsch (hlavní vývojář 2013–2020)
Své komentáře, návrhy či dotazy posílejte na mediawiki-api@lists.wikimedia.org nebo založte chybové hlášení na https://phabricator.wikimedia.org/.