RESEARCH ARTICLE Automatic approach-avoidance tendencies as a candidate intermediate phenotype for depression: Associations with childhood trauma and the 5-HTTLPR transporter polymorphism Pascal Fleurkens1*, Agnes van Minnen1,2, Eni S. Becker1, Iris van Oostrom3, a1111111111 Anne Speckens3, Mike Rinck1, Janna N. Vrijsen3,4 a1111111111 a1111111111 1 Behavioural Science Institute, Radboud University Nijmegen, Nijmegen, The Netherlands, a1111111111 2 Psychotrauma Expertise Centrum (PSYTREC), Bilthoven, The Netherlands, 3 Department of Psychiatry, a1111111111 Radboud University Medical Centre, Nijmegen, The Netherlands, 4 Pro Persona: Institution for Integrated Mental Health Care, Nijmegen, The Netherlands *
[email protected]OPEN ACCESS Citation: Fleurkens P, van Minnen A, Becker ES, Abstract van Oostrom I, Speckens A, Rinck M, et al. (2018) Depression risk genes in combination with childhood events have been associated with Automatic approach-avoidance tendencies as a candidate intermediate phenotype for depression: biased processing as an intermediate phenotype for depression. The aim of the present Associations with childhood trauma and the 5- conceptual replication study was to investigate the role of biased automatic approach-avoid- HTTLPR transporter polymorphism. PLoS ONE 13 ance tendencies as a candidate intermediate phenotype for depression, in the context of (3): e0193787. https://doi.org/10.1371/journal. genes (5-HTTLPR polymorphism) and childhood trauma. A naturalistic remitted depressed pone.0193787 patients sample (N = 209) performed an Approach-Avoidance Task (AAT) with facial Editor: Judith Homberg, Radboud University expressions (angry, sad, happy and neutral). Childhood trauma was assessed with a ques- Medical Centre, NETHERLANDS tionnaire. Genotype groups were created based on allele frequency: LaLa versus S/Lg-carri- Received: November 5, 2017 ers. The latter is associated with depression risk. We found that remitted S/Lg-carriers who Accepted: February 17, 2018 experienced childhood trauma automatically avoided sad facial expressions relatively more Published: March 16, 2018 than LaLa homozygotes with childhood trauma. Remitted LaLa-carriers who had not experi- Copyright: © 2018 Fleurkens et al. This is an open enced childhood trauma, avoided sad faces relatively more than LaLa homozygotes with access article distributed under the terms of the childhood trauma. We did not find a main effect of childhood trauma, nor differential avoid- Creative Commons Attribution License, which ance of any of the other facial expressions. Although tentative, the results suggest that auto- permits unrestricted use, distribution, and matic approach-avoidance tendencies for disorder-congruent materials may be a fitting reproduction in any medium, provided the original author and source are credited. intermediate phenotype for depression. The specific pattern of tendencies, and the relation to depression, may depend on the genetic risk profile and childhood trauma, but replication Data Availability Statement: The study data include clinical details on past personal experiences is needed before firm conclusions can be drawn. of the patients and are therefore sensitive. When the study was conducted, data sharing was not facilitated by the Department of Psychiatry, Radboud University Medical Centre. Data can be requested through the coordinating researcher, Janna Vrijsen (
[email protected]); data manager, Geert Schattenberg (Geert.
[email protected]); or general email PLOS ONE | https://doi.org/10.1371/journal.pone.0193787 March 16, 2018 1 / 13 Depression and associations between 5-HTTLPR, childhood trauma and approach avoidance tendencies address: nscpsychiatriesecretariaatmedewerkers@ Introduction umcn.nl. Major depressive disorder is highly prevalent and is associated with high personal and societal Funding: This research did not receive any specific costs [1–3]. Recurrence of the disorder is very common [4]. It is therefore important to study grant from funding agencies in the public, commercial, or not-for-profit sectors. underlying biological and cognitive risk factors for depression, in order to increase under- standing of the etiology of depression and possible targets for intervention. Competing interests: The authors have declared The serotonin transporter gene (SLC6A4), and especially a polymorphism in the promoter that no competing interests exist. region (5-HTTLPR), have been linked to depressive symptoms [5]. The 5-HTTLPR polymor- phism has a ‘short’ (S) and a ‘long’ (L) form, referring to the number of base pairs in the region. The function of the L allele is influenced by a single-nucleoid polymorphism or SNP (rs25531), which consists of an A and a G allele (La and Lg). Importantly, the ‘short’ (S) form as well as the Lg variant have been associated with depression risk, because they restrict the tran- scriptional activity of the promoter, resulting in low functional expression of SLC6A4, and hence reduced re-uptake of serotonin [6]. Genetic expression probably depends on lifetime experiences [7]. Childhood trauma is a strong contributor to the development of psychopathology such as depression [8]. A recent meta-analysis [9] again confirmed life stressors to be a strong risk factor for depression. In contrast, the meta-analysis failed to show a main effect of 5-HTTLPR or an interaction of 5-HTTLPR x Stress on depression. The challenged validity of this stress sensitivity hypothesis by inconsistent results might stem from a restricted focus on depression phenotypes as the out- come of interest, as opposed to intermediate or transdiagnostic conditions [10,11]. Intermedi- ate phenotypes are processes that are more proximal to the disorder than genes [7] and are thought to lay between the gene and clinically observable mental disorders. Studies into inter- mediate phenotypes are therefore considered a strong and reliable way of studying genetic influences and interactions with environmental factors [7,11,12]. Depression is characterized by biased processing of emotional information [13]. Impor- tantly, genetic risk alleles and childhood trauma have been associated with biased processing as an intermediate phenotype for depression [11,14,15]. Most intermediate phenotype studies were conducted in healthy / community samples [10,16,17,18,19], and only some focused on clinical samples [20,21,22]. These studies typically point out that risk-allele carriers who expe- rienced childhood trauma show most negative and least positive biased information process- ing. Cognitive processes such as attention, interpretation and memory have received most attention in this field. However, biased and aberrant behavioral approach-avoidance tenden- cies are also characteristic of and a risk factor for depression [23]. Specifically, avoidance is thought to limit the access to both negative and positive reinforcers, and promote negative information processing in depression. This seems especially relevant in the context of facial expressions, which communicate emotional states and direct behavior [24]. It is hypothesized that 5-HTTLPR is linked to these approach-avoidance tendencies. There is evidence that variation in 5-HTTLPR functioning is related to stress-sensitivity and response to negative cues. Beevers et al. [25], for example, found less attentional focus on negative com- pared to positive information in S/Lg-carriers, possibly indicating avoidance of negativity. Neurocognitive studies, furthermore, indicated that in response to negative information carri- ers of the short allele compared to carriers of the long allele 1) displayed a clear lateral shift of dorsolateral frontal activity to the right [26], and 2) showed heightened amygdale activity [27]. These neurocognitive responses are associated with avoidance-oriented motivation [26], indi- cating a mechanistic association between serotonin regulation and avoidance behavior. In line, recently, in a sample of PTDS patients, variation in the 5-HTTLPR polymorphism has been linked to avoidance behavior [28]. Corroborating evidence comes from pharmacological PLOS ONE | https://doi.org/10.1371/journal.pone.0193787 March 16, 2018 2 / 13 Depression and associations between 5-HTTLPR, childhood trauma and approach avoidance tendencies studies, where serotonergic medication has been found to reduce avoidance behavior in PTSD-patients [29]. Most studies on approach-avoidance behavior are based on self-report measures. A disad- vantage of self-report is that it is limited to conscious processes, while missing out on more implicit processes [30,31] The Approach-Avoidance Task (AAT) [32] is a frequently used task to assess automatic approach-avoidance tendencies. Using the AAT, automatic approach- avoidance tendencies have been assessed in various disorders (e.g. Posttraumatic Stress Disor- der (PTSD) [33]; fear of spiders: Klein, Becker, & Rinck [34]; social anxiety [35]; pathological skin picking [36]; and addictions [37], for a recent meta-analysis, see [38]). Although AAT results in depression are limited and inconsistent, automatic approach-avoidance tendencies are probably important in depression [39,40,41,42]. Seidel and colleagues [42], for example, found that depressed patients showed automatic avoidance in response to angry faces. Bartos- zek and Winer [39] found that, in a student sample, those with depressive symptoms showed less automatic approach for positive pictures (non-faces) compared to neutral stimuli. This calls for further investigation. In line with earlier intermediate phenotype findings, in the current conceptual replication we examined the hypothesized association of automatic approach-avoidance tendencies as a candidate intermediate phenotype for depression with the 5-HTTLPR polymorphism in inter- action with childhood trauma. To our knowledge, the current study is the first study with this objective, and we therefore stress the tentative nature of the results and subsequent conclu- sions. Different from most other studies focusing on community samples, a naturalistic sample of remitted depressed patients was selected for the current study. This sample allows for the study of small genetic effects on intermediate phenotypes without the strong influence of cur- rent depressive symptoms [43,44]. In line with earlier studies, a sad mood induction procedure was used to activate depressotypic automatic processing and to align mood state [45,46]. Given the possible role of automatic approach-avoidance tendencies in depression, we explored automatic approach-avoidance tendencies as an intermediate phenotype for depres- sion. Although we do not have previous genetic research to base our hypotheses on, based on clinical experiences, information processing theories in depression and the research by Seidel and colleagues [42], we expected avoidance of negative (sad, angry) facial expressions in remit- ted depressed S/Lg-carriers who have experienced childhood trauma, as this represents the most vulnerable subgroup. Following Culverhouse and colleagues [9], we expected a main effect of childhood trauma on automatic approach-avoidance tendencies in depression. Materials and methods Participants This study is part of the ‘Info in Genes’ study, which involves a total of 337 remitted depressed patients. In the ‘Info in Genes’ study, the role of cognitive biases and genetic susceptibility to depression is investigated by assessing biased processing in several domains in remitted depressed patients [20,21,22]. Included were those who met DSM-IV-TR criteria [1] for at least one previous Major Depressive episode (primary diagnosis). All remitted depressed indi- viduals were recruited via the Department of Psychiatry of the Radboud University Medical Center. The following exclusion criteria were used: Current depressive episode, current or life- time bipolar disorder and/or schizophrenia, current psychotic symptoms, substance abuse or dependence over the past 6 months, neurological disorder, sensorimotor handicap, intellectual disability, and deafness. Eligible participants were interviewed using the Structured Clinical Interview for the DSM-IV Axis-I disorders (SCID-I) [47,48] by trained professionals under the supervision of a psychiatrist (author AS). The SCID-I has fair test-retest reliability and fair- PLOS ONE | https://doi.org/10.1371/journal.pone.0193787 March 16, 2018 3 / 13 Depression and associations between 5-HTTLPR, childhood trauma and approach avoidance tendencies to-excellent inter-rater reliability [49]. AAT data were collected and available for 224 remitted depressed patients. The data of 3 patients with > 24% errors were removed from the dataset. Blood samples of eight patients were not available and genotyping failed for two participants. Another two participants were excluded because of a previous cardio-vascular accident and a recent transient ischaemic attack, resulting in a sample of 209 remitted depressed patients for data-analyses. The study was approved by the Dutch central medical ethics review board (P04.0599C), and all participants provided written informed consent. Measurements and materials Mood induction. Before the AAT, all participants saw a highly emotional sad 12-minute film segment of the movie ‘Sophie’s Choice’ [50]. They were instructed to let the emotionality of the film influence their mood as much as possible and to maintain the sad mood state. Approach-Avoidance Task. Color photos of 10 individuals (5 female, 5 male) from the Radboud Faces Database [51] were used. For each individual, one photo depicting an angry, sad, happy, and neutral expression each was selected. Additionally, 10 control pictures display- ing a chessboard pattern were included. By placing either a purple or a blue color filter over the picture, two versions of each of the 50 pictures were created, resulting in 100 picture sti- muli. An additional set of 18 mixed social and control pictures served as practice trials. A com- puter screen with a resolution of 1024 x 768 pixels and a ‘‘Logitech Attack 3” joystick were employed. Total administration of the AAT took approximately 10 minutes. Participants were instructed to push the joystick upon presentation of pictures with a blue filter, while the joystick had to be pulled for purple pictures. Pictures disappeared when the joystick was pushed or pulled all the way in the correct direction. Appearance of the next pic- ture was initiated by the participant by moving the joystick back to the central position and pulling the trigger button of the joystick. An unambiguous relation between movements and approach-avoidance behaviors was created by using a ‘zooming-effect’: When the joystick was pushed, the picture became smaller, and vice versa when it was pulled. This created the impres- sion that the picture disappeared or came closer, respectively. The time from appearance to disappearance of the picture was automatically recorded. These times were the participants’ reaction times, used to compute the dependent variables of the analyses described below. In a study concerning implicit avoidance of spiders, the internal consistency of the AAT was ade- quate for a reaction time task [52]. Stressful life events. Using an adapted version of the 21-item Life Events Questionnaire, which has good psychometric properties [53], participants were asked to indicate whether they had experienced a set of concrete life events before the age of 16 years, after the age of 16 and/ or within the last year. In line with Vrijsen and colleagues [20,21], a childhood trauma variable was calculated including the following four interpersonal trauma items: physical/verbal aggres- sion within the family, physical/verbal aggression outside the family, sexual abuse within the family and sexual abuse outside the family. This variable was coded ‘1’ when participants had experienced one of these events before the age of 16 years, and ‘0’ if they had not experienced these events before the age of 16. Genotyping. A blood sample was taken via venipuncture. DNA was isolated using stan- dard protocols. The 5-HTTLPR polymorphism was genotyped at the Department of Human Genetics of the Department of Human Genetics of the Radboud University Nijmegen Medical Center using Taqman analysis [54]. Two genotype groups were created based on allele fre- quency and in line with previous studies [55,56,57]: LaLa (LL) versus S/Lg-carriers (SLa/LaLg and SS/SLg/LgLg combined). The allele frequency distribution was LaLa: N = 54 (26%), SLa/ LaLg: N = 109 (52%), SS/SLg/LgLg: N = 46 (22%). Testing for Hardy–Weinberg equilibrium PLOS ONE | https://doi.org/10.1371/journal.pone.0193787 March 16, 2018 4 / 13 Depression and associations between 5-HTTLPR, childhood trauma and approach avoidance tendencies (HWE), which was adjusted for multi-allelic variants, did not show deviations from the expected distribution of genotypes (X2 = .42, df = 1, p = .52). Depression and other measures. All measures were administered before the AAT. Depressive symptomatology was measured with the Beck Depression Inventory-II (BDI-II) [58,59]. The BDI-II is a 21-item, self-report instrument that measures severity of depression, and has good to excellent psychometric properties [60]. Social anxiety was measured with the anxiety scale (24 items) of the Liebowitz Social Anxiety Scale [61]. The LSAS had good psycho- metric properties [62]. Age of onset of the first depressive episode, as well as the number of depressive episodes were assessed with separate questions and confirmed during the clinical interview (SCID-I). Current use of medication prescribed for anxiety, mood or sleep problems was assessed by a psychiatrist (author AS). Design and statistical analyses To reduce the influence of outlying data points, RTs in the top and bottom 1% of the distribu- tion were eliminated. Initial pull instead of push full movements and vice versa were consid- ered errors. On average, error rates were low, less than 1%. Median RTs were computed for each participant for each combination of facial expression (angry, sad, happy, neutral) and movement (push, pull). An approach-avoidance score was calculated per facial expression by subtracting the median scores of pull trials from the push trials (push–pull). Negative approach-avoidance scores indicate faster avoidance than approach, and positive values indi- cate faster approach than avoidance. These approach-avoidance scores were used as the depen- dent variable in the analyses of the AAT. Differences between the two genotype groups on diverse demographic and clinical measures were analyzed with t-tests and Chi-square tests. Because of their known effect on cognitive functioning and emotional processing, age and sex were included as covariates in the main analyses. The 3-way interaction of the between-sub- jects factors Genotype (LaLa vs. S/Lg-carriers) and Childhood trauma (no vs. yes) with the within-subjects factor Facial expression (angry, sad, happy, neutral) on approach-avoidance scores was analyzed using repeated-measures ANCOVA. Results Sample descriptives and statistical tests comparing the four combined childhood trauma (no, yes) and genotype (LaLa, S/Lg-carriers) groups on demographic and clinical variables are pre- sented in Table 1. The groups did not differ on age, sex distribution, medication use, BDI-II total score, LSAS total score, age of depression onset, or number of past depressive episodes. Last, the genotype groups LaLa (28%) and S/Lg-carriers (39%) did not differ in terms of per- centage of experienced childhood trauma, χ2(1, N = 209) = 2.32, p = .128. 5-HTTLPR genotype and childhood trauma interaction on approach- avoidance tendencies The 5-HTTLPR Genotype (LaLa vs. S/Lg carriers) x Childhood trauma (no vs. yes) x Facial expression (angry, sad, happy, or neutral) ANCOVA yielded no main effect of 5-HTTLPR Genotype, nor main effects of Childhood trauma or Facial expression on approach-avoidance scores, F(1,203) = .05, p = .828, ηp2 < .001, F(1,203) = 2.74, p = .099, ηp2 = .013, and F(3,201) = .30, p = .827, ηp2 = .004, respectively. As predicted, the ANCOVA did yield a significant three-way interaction of 5-HTTLPR Genotype x Childhood trauma x Facial expression on approach-avoidance scores, F(3,201) = 2.94, p = .034, η2 = .042. To rule out the possible role of current depressive and (social) anxiety symptoms, the Genotype x Childhood trauma x Facial expression ANCOVA was repeated in PLOS ONE | https://doi.org/10.1371/journal.pone.0193787 March 16, 2018 5 / 13 Depression and associations between 5-HTTLPR, childhood trauma and approach avoidance tendencies Table 1. Statistical tests comparing the combined childhood trauma (no, yes) and genotype (LaLa, S/Lg-carriers) groups on demographic and clinical variables. Means (Standard Deviations) or percentages are presented per variable. Group Variables LaLa + No childhood LaLa + Childhood trauma S/Lg-carriers + No childhood S/Lg-carriers + Childhood Statistical test trauma (N = 39) (N = 15) trauma (N = 94) trauma (N = 61) Age 50.5 (11.31) 45.67 (9.15) 49.57 (12.23) 48.64 (10.27) F(3,205) = .75, p = .522 Sex, female 64% 73% 54% 72% χ2(3, N = 209) = 5.94, p = .114 Medication 51% 47% 47% 54% χ2(3, N = 208) = .771, use p = .856 BDI-II 15.4 (7.57) 14.23 (13.60) 14.14 (10.10) 15.31 (10.23) F(3,205) = .24, p = .869 LSAS 23.8 (14.72) 18.68 (13.76) 18.82 (11.68) 20.67 (12.62) F(3,205) = 1.51, p = .214 Age of onset 31.9 (12.31) 22.83 (10.39) 29.89 (12.64) 26.97 (13.36) F(3,205) = 2.55, p = .057 Number of 1.7 (.442) 1.93 (.258) 1.80 (.404) 1.84 (.373) F(3,205) = .98, p = episodes .405 Note. BDI-II refers to the score on the Beck Depression Inventory, LSAS refers to the Liebowitz Social Anxiety Scale, Age of onset refers to the age of the first depressive episode and Number of episodes refers to the number of depressive episodes (both indicated by the patient). https://doi.org/10.1371/journal.pone.0193787.t001 participants with a BDI-II Total score < 20 (N = 143), as well as in participants with an LSAS anxiety score < 19 (N = 104; based on the median LSAS score in our sample). Both analyses yielded similar results to the analysis in the full sample, F(3,135) = 4.56, p = .004, ηp2 = .09 for the BDI-II selection, and F(3,96) = 2.42, p = .070, ηp2 = .07 for the LSAS selection. Because the trauma and genotype groups differed at trend level on age of depression onset (see Table 1), and because age of onset is an important clinical predictor of depression severity and recur- rence [63], its possible role was ruled out by including it as a covariate in the initial Genotype x Childhood trauma x Facial expression ANCOVA. This analysis also revealed very similar results compared with the initial ANCOVA, F(3,200) = 2.97, p = .033, ηp2 = .043. The 5-HTTLPR Genotype x Childhood trauma interaction was significant for responses to sad facial expressions, F(1,203) = 6.73, p = .010, ηp2 = .032. Post-hoc power analyses using the G power power calculator (http://www.gpower.hhu.de) showed that the power for the 5-HTTLPR x Childhood trauma interaction, at the 5% level, was 85%. For the facial expres- sions happy, angry and neutral, no significant two-way interaction was found, F(1,203) = 2.90, p = .09, ηp2 = .014, F(1,203) < .01, p = .964, ηp2 < .001, and F(1,203) = 1.70, p = .685, ηp2 = .001, respectively. Further post-hoc analyses of responses to sad faces revealed that remitted depressed S/Lg- carriers with childhood trauma (M = -7, SD = 85) avoided sad faces relatively more compared to patients with the LaLa genotype with childhood trauma (M = 57, SD = 54), F(1,72) = 9.05, p = .004, ηp2 = .112 (Fig 1). Furthermore, LaLa individuals without childhood trauma (M = -12, SD = 122) avoided sad faces relatively more than LaLa individuals with childhood trauma (M = 57, SD = 54), F(1,50) = 4.46, p = .040, partial ηp2 = .082. The two ANCOVA’s comparing the approach-avoidance scores for sad expressions of S/Lg-carriers without childhood trauma (M = 14 , SD = 98) to LaLa individuals with trauma, and the scores of S/Lg-carriers without childhood trauma to S/Lg-carriers with childhood trauma did not reveal significant differ- ences, for both p > .26. PLOS ONE | https://doi.org/10.1371/journal.pone.0193787 March 16, 2018 6 / 13 Depression and associations between 5-HTTLPR, childhood trauma and approach avoidance tendencies Fig 1. Median approach-avoidance scores (ms), interquartile range, outliers and extreme cases for sad faces, for the combined childhood trauma (yes vs. no) and genotype groups (S/Lg-carriers vs. LaLa). https://doi.org/10.1371/journal.pone.0193787.g001 Comparison of genotype and childhood trauma groups on clinical variables Depression characteristics are associated with depression severity, persistence and level of adjustment after a recovery from a depressive episode [64]. Therefore, post-hoc analyses were used to study possible differences in the age of onset of the first depressive episode and number of depressive episodes, which might account for the results found on approach-avoidance ten- dencies towards sad faces. However, the 5-HTTLPR Genotype x Childhood trauma interaction was not significant, neither for age of onset of the first depressive episode nor for number of depressive episodes, F(1,203) = 1.54, p = .217, ηp2 = .008, and F(1,203) = 1.57, p = .212, ηp2 = .008, respectively. Discussion Within a naturalistic sample of remitted depressed patients, we found preliminary evidence for differential automatic avoidance of sad facial expressions based on interindividual differ- ences in 5-HTTLPR genotype and the experience of childhood trauma. S/Lg-carrying remitted depressed patients with childhood trauma automatically avoided sad facial expressions rela- tively more than LaLa homozygotes with childhood trauma, even after controlling for age of depression onset, residual depressive symptoms, and social anxiety. Although tentative, this result fits with previous results suggesting that S/Lg-carriers show more avoidance behavior than LaLa-carriers [26,28], and that they may be most susceptible to the effects of childhood trauma [11]. It also conforms with findings that S/Lg-carriers generally show less emotional and psychological resilience than LaLa-carriers [65]. Variance in approach-avoidance tenden- cies indicates differential automatic response to emotional material [38]. Together, this PLOS ONE | https://doi.org/10.1371/journal.pone.0193787 March 16, 2018 7 / 13 Depression and associations between 5-HTTLPR, childhood trauma and approach avoidance tendencies preliminary result may indicate that automatic approach-avoidance tendencies are not only a symptom of depression, but may be a marker for depression vulnerability. Secondly, and contrary to our expectation that pronounced differences in biased approach- avoidance tendencies would be found in the more vulnerable S/Lg-carriers, the present prelim- inary results showed that remitted depressed patients with the LaLa genotype who had not experienced trauma during childhood avoided sad faces relatively more than LaLa-homozy- gotes with childhood trauma. This is unexpected for several reasons. As stated above, LaLa-car- riers are usually the least vulnerable group. Furthermore, the LaLa genotype is generally not associated with avoidance and depressotypic behavior, nor with susceptibility to environmen- tal factors such as childhood trauma [66]. Last, from a clinical perspective, one might expect avoidance in people with childhood trauma, and not in those who did not experience it. Although speculative until replicated, this result may indicate that the generally less vulnerable LaLa-homozygotes who experience adversity during childhood are perhaps best equipped to recover from trauma and even face-related cues. In line with Seidel and colleagues [42], we expected automatic avoidance of angry faces as well. We did not find this, however. The present results are tentative, but perhaps the signaling of sad rather than angry expressions is most relevant for depression. This would correspond with information processing models in depression: Sad faces are congruent to depressed patients’ mood state, activating depressotypic schemas, which lead to biased processing. This is corroborated by our finding that symptoms of social anxiety (LSAS) did not influence results. Surprisingly, and also in contrast to our expectations and findings emphasizing the role of childhood trauma in depression [8,9], we did not find a main effect of childhood trauma, nor did S/Lg-carriers with childhood trauma show more automatic avoidance of sad expressions than S/Lg-carriers without childhood trauma. Due to the tentative nature of this study, we can- not draw firm conclusions about this finding. Although tentatively, it might show, however, that childhood trauma does not exclusively contribute to depression. Rather, its effect on depressive behavior may depend on underlying biological variation, such as variance in the 5-HTTLPR polymorphism. Taken together, the present findings correspond with previous studies showing an associa- tion between 5-HTTLPR and avoidance [26,28], and models of biased information processing in depression [67,68]. In line with other intermediate phenotype findings, our conceptual rep- lication partly supports earlier G x E findings, linking automatic biased processing of emo- tional information to genetic risk profiles and childhood trauma [10,11,14,16–22]. We extended these findings to a naturalistic sample of (previously) depressed individuals and spe- cifically found that automatic avoidance tendencies of sad faces might be one of the intermedi- ate phenotypes mediating the relationship between genes and depression vulnerability. However, the specific pattern of results was (partly) unexpected. These results are preliminary and replications are needed before firm conclusions can be drawn, so possible clinical considerations are speculative. If substantiated in larger samples, the results might contribute to the development of more personalized healthcare, targeting patients’ specific risk factors such as genetic and cognitive profiles [69,70]. In line with Accep- tance and Commitment Therapy [71], the present study stresses the possibility of experiential avoidance of negative emotions and cognitions as a crucial factor in (the recurrence of) depres- sion, and possible working mechanisms for intervention. The degree to which automatic avoidance remains present after treatment might be an independent predictor of recurrence of depression. In line with Cognitive Bias Modification (CBM) interventions, such as the approach-positivity training for depression developed by Becker and colleagues [72], it would be interesting to study the feasibility of directly modifying automatic approach-avoidance ten- dencies in depression [73]. The 5-HTTLPR gene allelic variations might alter sensitivity to PLOS ONE | https://doi.org/10.1371/journal.pone.0193787 March 16, 2018 8 / 13 Depression and associations between 5-HTTLPR, childhood trauma and approach avoidance tendencies CBM [74], underscoring the relevance of identifying genetic profiles in depressed patients. Possible future clinical applications such as these are still hypothetical and, of course, more research is needed. The present findings cannot be interpreted without discussing several limitations of the study. The relatively modest sample size of the present study (N = 209) must be taken into account when evaluating the results. Post-hoc power analyses [75], however, showed that power was sufficient for detecting the 5-HTTLPR x Childhood trauma interaction. Although we consider our naturalistic sample of remitted depressed patients as typical and representa- tive, studying such a group has disadvantages. Biased processing, for example, might reflect a susceptibility factor as well as scars from previous depressive episodes [76]. Relatedly, this is neither a prospective nor an experimental study, so no causal interpretations can be drawn. Another limitation is the method of assessing childhood trauma with the self-report Life Events Questionnaire [53]. Although others state that adults’ recall of specific childhood events seems fairly accurate [77], relying on self-report could have confounded the present results to some extent [10]. In line with Vrijsen and colleagues [22], we used a rather stringent selection of childhood trauma events. This might have resulted in a lower incidence of childhood trauma than in related studies [78]. However, despite these limitations, the tentative results of this explorative study suggest that automatic approach-avoidance tendencies might be a candidate intermediate phenotype for depression. The specific pattern of these tendencies may depend on genetic profile and the experience of childhood trauma. Although this might endorse the complex and multilateral etiology of depression, and the relevance of integrating depression risk factors at different lev- els (genetic, information processing, psychosocial), replications using larger samples are needed for substantiation of the findings and for clarifying the specific association between genetic variance, childhood experiences and approach-avoidance behavior. Author Contributions Conceptualization: Eni S. Becker, Iris van Oostrom, Anne Speckens, Janna N. Vrijsen. Data curation: Pascal Fleurkens, Janna N. Vrijsen. Formal analysis: Pascal Fleurkens, Agnes van Minnen, Eni S. Becker, Mike Rinck, Janna N. Vrijsen. Investigation: Janna N. Vrijsen. Methodology: Eni S. Becker, Iris van Oostrom, Anne Speckens, Janna N. Vrijsen. Project administration: Janna N. Vrijsen. Supervision: Agnes van Minnen, Mike Rinck, Janna N. Vrijsen. Writing – original draft: Pascal Fleurkens, Agnes van Minnen, Mike Rinck, Janna N. Vrijsen. Writing – review & editing: Eni S. Becker, Iris van Oostrom, Anne Speckens. References 1. American Psychiatric Association. Diagnostic and statistical manual of mental disorders. 4th ed. text rev. Washington DC: Author;2000. 2. Richards D. Prevalence and clinical course of depression: a review. Clin Psychol Rev. 2011; 31:1117– 25. https://doi.org/10.1016/j.cpr.2011.07.004 PMID: 21820991 3. Donohue JM, Pincus HA. Reducing the societal burden of depression: a review of economic costs, qual- ity of care and effects of treatment. Pharmacoeconomics. 2007; 25:7–24. PMID: 17192115 PLOS ONE | https://doi.org/10.1371/journal.pone.0193787 March 16, 2018 9 / 13 Depression and associations between 5-HTTLPR, childhood trauma and approach avoidance tendencies 4. Monroe SM, Harkness KL. Recurrence in major depression: a conceptual analysis. Psychol Rev. 2011; 118:655–74. https://doi.org/10.1037/a0025190 PMID: 21895384 5. Kenna GA, Roder-Hanna N, Leggio L, Zywiak WH, Clifford J, Edwards S, et al. Association of the 5- HTT gene-linked promoter region (5-HTTLPR) polymorphism with psychiatric disorders: review of psy- chopathology and pharmacotherapy. Pharmgenomics Pers Med. 2012; 5:19–35. https://doi.org/10. 2147/PGPM.S23462 PMID: 23226060 6. Caspi A, Hariri A, Holmes A, Uher R, Moffitt TE. Genetic sensitivity to the environment: the case of the serotonin transporter gene and its implications for studying complex diseases and traits. Am J Psychia- try. 2010; 167:509–27. https://doi.org/10.1176/appi.ajp.2010.09101452 PMID: 20231323 7. Gottesman II, Gould TD. The endophenotype concept in psychiatry: etymology and strategic intentions. Am J Psychiatry. 2003; 160:636–45. https://doi.org/10.1176/appi.ajp.160.4.636 PMID: 12668349 8. Hammen CL, Garber J, Ingram RE. Vulnerability to depression across the lifespan. In Ingram RE, Price JM, editors. Vulnerability to Psychopathology: Risk across the lifespan. 2nd ed. New York: Guilford Press; 2010. p. 282–90. 9. Culverhouse RC, Saccone NL, Horton AC, Ma Y, Anstey KJ, Banaschewski T, et al. Collaborative meta-analysis finds no evidence of a strong interaction between stress and 5-HTTLPR genotype con- tributing to the development of depression. Mol Psychiatry. 2017 Apr 4. 10. Conway CC, Slavish GM, Hammen C. Daily stress reactivity and serotonin transporter gene (5- HTTLPR) variation: internalizing responses to everyday stress as a possible transdiagnostic phenotype. Biol Mood Anxiety Disord. 2014;4. https://doi.org/10.1186/2045-5380-4-4 11. Gibb BE, Beevers CG, McGeary JE. Toward an integration of cognitive and genetic models of risk for depression. Cogn Emot. 2013; 27:193–216. https://doi.org/10.1080/02699931.2012.712950 PMID: 22920216 12. Kendler KS, Neale MC. Endophenotype: a conceptual analysis. Mol Psychiatry. 2010; 15:789–97. https://doi.org/10.1038/mp.2010.8 PMID: 20142819 13. Gotlib IH, Joormann J. Cognition and depression: current status and future directions. Annu Rev Clin Psycho, 2010; 6:285–312. 14. Goldstein BL, Klein DN. A review of selected endophenotypes for depression. Clin Psychol Rev. 2014; 34:417–27. https://doi.org/10.1016/j.cpr.2014.06.003 PMID: 25006008 15. Hornung OP, Heim CM. Gene–environment interactions and intermediate phenotypes: early trauma and depression. Fron Endocrinol. 2014;5. 16. Hankin BL, Young JF, Abela JR, Smolen A, Jenness JS. Gulley JD, et al. Depression from childhood into late adolescence: Influence of gender, development, genetic susceptibility, and peer stress. J Abnorm Psychol. 2015; 124:803–16. https://doi.org/10.1037/abn0000089 PMID: 26595469 17. Jenness JL, Hankin BL, Young JF, Smolen A. Stressful life events moderate the relationship between genes and biased attention to emotional faces in youth. Clin Psychol Sci. 2016; 4:386–400. https://doi. org/10.1177/2167702615601000 PMID: 27375963 18. Jenness JL, Young JF, Hankin BL. 5-HTTLPR moderates the association between attention away from angry faces and prospective depression among youth. J Psychiatr Res. 2017; 91:83–89. https://doi.org/ 10.1016/j.jpsychires.2017.02.023 PMID: 28325682 19. Van Oostrom I, Franke B, Rijpkema M, Gerritsen L, Arias-Vásquez A, Fernández G, et al. Interaction between BDNF Val66Met and childhood stressful life events is associated to affective memory bias in men but not women. Biol Psychol. 2012; 89:214–219. https://doi.org/10.1016/j.biopsycho.2011.10.012 PMID: 22033217 20. Vrijsen JN, van Oostrom I, Arias-Vásquez A, Franke B, Becker E, Speckens A. Association between genes, stressful childhood events and processing bias in depression vulnerable individuals. Genes Brain Beh. 2014; 13:508–516. 21. Vrijsen JN, Speckens A, Arias-Vásquez A, Franke B, Becker E, van Oostrom I. No evidence for the association between a polymorphism in the PCLO depression candidate gene with memory bias in remitted depressed patients and healthy individuals. PLoS One. 2014;9. 22. Vrijsen JN, Vogel S, Arias-Vásquez A, Franke B, Fernández G, Becker ES, et al. Depressed patients in remission show an interaction between variance in the mineralocorticoid receptor NR3C2 gene and childhood trauma on negative memory bias. Psychiatr Genet. 2015; 25:99–105. https://doi.org/10. 1097/YPG.0000000000000081 PMID: 25714450 23. Trew J. Exploring the roles of approach and avoidance in depression: an integrative model. Clin Psychol Rev. 2011; 31:1156–1168. https://doi.org/10.1016/j.cpr.2011.07.007 PMID: 21855826 24. Stuhrmann A, Suslow T, Dannlowski U. Facial emotion processing in major depression: a systematic review of neuroimaging findings. Biol Mood Anxiety Disord. 2011; 1:1–17. https://doi.org/10.1186/2045- 5380-1-1 PLOS ONE | https://doi.org/10.1371/journal.pone.0193787 March 16, 2018 10 / 13 Depression and associations between 5-HTTLPR, childhood trauma and approach avoidance tendencies 25. Beevers CG, Marti CN, Lee HJ, Stote DL, Ferrell RE, Hariri HR, et al. Associations between serotonin transporter gene promoter region (5-HTTLPR) polymorphism and gaze bias for emotional information. J Abnorm Psychol. 2011; 120:187–97. https://doi.org/10.1037/a0022125 PMID: 21319930 26. Papousek I, Reiser EM, Schulter G, Fink A, Niederstätter H, Nagl S, et al. Serotonin transporter geno- type (5-HTTLPR) and electrocortical responses indicating the sensitivity to negative emotional cues. Emotion. 2013; 13:1173–81. https://doi.org/10.1037/a0033997 PMID: 24040881 27. Von dem Hagen EAH, Passamonti L, Nutland S, Sambrook J, Calder AJ. The serotonin transporter gene polymorphism and the effect of baseline on amygdala response to emotional faces. Neuropsycho- logia. 2011; 49:674–680. https://doi.org/10.1016/j.neuropsychologia.2010.12.013 PMID: 21167188 28. Liu L, Wang L, Cao C, Cao X, Zhu Y, Liu P, et al. Serotonin transporter 5-HTTLPR genotype is associ- ated with intrusion and avoidance symptoms of DSM-5 posttraumatic stress disorder (PTSD) in Chi- nese earthquake survivors. Anxiety Stress Coping. 2017:1–10. 29. Cassano GB, Rossi NB, Pini S. Psychopharmacology of anxiety disorders. Dialogues Clin Neurosci. 2002; 4:271–85. PMID: 22033867 30. Beevers CG. Cognitive vulnerability to depression: a dual process model. Clin Psychol Rev. 2015;25975–1002. 31. Strack F, Deutsch R. Reflective and impulsive determinants of social behavior. Pers Soc Psychol Rev. 2004; 8:220–247. https://doi.org/10.1207/s15327957pspr0803_1 PMID: 15454347 32. Rinck M. Becker ES. Approach and avoidance in fear of spiders. J Behav Ther Exp Psychiatry. 2007; 38:105–120. https://doi.org/10.1016/j.jbtep.2006.10.001 PMID: 17126289 33. Fleurkens P, Rinck M. van Minnen A. Implicit and explicit avoidance in sexual trauma victims suffering from posttraumatic stress disorder: a pilot study. Eur J Psychotraumatol, 2014;5. 34. Klein A, Becker ES, Rinck. Approach and avoidance tendencies in spider-fearful children: the approach-avoidance task. J Child Fam Stud. 2011;20,224–231. 35. Heuer K, Rinck M, Becker ES. Avoidance of emotional facial expressions in social anxiety: The Approach-Avoidance Task. Behav Res Ther. 2007; 45:2990–3001. https://doi.org/10.1016/j.brat.2007. 08.010 PMID: 17889827 36. Schuck K, Keijsers GPJ, Rinck M. Implicit responses to skin irregularities predict symptom severity and treatment susceptibility in pathological skin picking. J Behav Ther Exp Psychiatry. 2012; 43:685–691. https://doi.org/10.1016/j.jbtep.2011.09.004 PMID: 21979149 37. Wiers RW, Rinck M, Dictus M, & van den Wildenberg E. Relatively strong automatic appetitive action tendencies in male carriers of the OPRM1 G-Allele. Genes Brain Behav. 2009; 8:101–106. https://doi. org/10.1111/j.1601-183X.2008.00454.x PMID: 19016889 38. Phaf RH, Mohr SE, Rotteveel M, Wichters JM. Approach, avoidance, and affect: a meta-analysis of approach-avoidance tendencies in manual reaction time tasks. Front Psychol. 2014; 5. 39. Bartoszek G, Winer ES. Spider-fearful individuals hesitantly approach threat, whereas depressed indi- viduals do not persistently approach reward. J Behav Ther Exp Psychiatry. 2015; 46:1–7. https://doi. org/10.1016/j.jbtep.2014.07.012 PMID: 25164091 40. Derntl B, Seidel E-M, Eickhoff SB, Kellermann T, Gur RC, Schneider F, et al. Neural correlates of social approach and withdrawal in patients with major depression. Soc Neurosci. 2011; 6:482–501. https://doi. org/10.1080/17470919.2011.579800 PMID: 21777105 41. Radke S, Güths F, André JA, Müller BW, de Bruijn ERA. In action or inaction? Social approach-avoid- ance tendencies in major depression. Psychiatry Res. 2014; 219:513–17. https://doi.org/10.1016/j. psychres.2014.07.011 PMID: 25060832 42. Seidel E-M, Habel U, Finkelmeyer A, Schneider F, Gur RC, Derntl B. Implicit and explicit behavioral ten- dencies in male and female depression. Psychiatry Res. 2010; 177:124–30. https://doi.org/10.1016/j. psychres.2010.02.001 PMID: 20199811 43. Bhagwagar Z, Cowen PJ. It’s not over when it’s over: persistent neurobiological abnormalities in recov- ered depressed patients. Psychol Med. 2007; 38:307–313. 44. Kar Gupta R. Attention and memory biases as stable abnormalities among currently depressed and cur- rently remitted individuals with unipolar depression. Front Psychiatry. 2012;3. 45. McCabe SB, Gotlib IH, Martin RA. Cognitive vulnerability for depression: deployment of attention as a function of history of depression and current mood state. Cog Ther Res. 2000; 24:427–44. 46. Scher CD, Ingram RE, Segal ZV. Cognitive reactivity and vulnerability: empirical evaluation of construct activation and cognitive diatheses in unipolar depression. Clin Psychol Rev. 2005; 25: 487–510. https:// doi.org/10.1016/j.cpr.2005.01.005 PMID: 15914266 47. First MB, Spitzer RL, Gibbon M, Williams JBW. Structured Clinical Interview for DSM-IV Axis I disorders (SCID I). New York: Biometric Research Department;1997 PLOS ONE | https://doi.org/10.1371/journal.pone.0193787 March 16, 2018 11 / 13 Depression and associations between 5-HTTLPR, childhood trauma and approach avoidance tendencies 48. Van Groenestijn MAC, Akkerhuis GW, Kupka RW, Schneider N., Nolen WA. Structured Clinical Inter- view for DSM-IV Axis I disorders (SCID-I). Lisse: Swets & Zeitlinger;1999. Dutch. 49. Lobbestael J, Leurgans M, Arntz A. Inter-rater reliability of the Structured Clinical Interview for DSM-IV Axis I Disorders (SCID I) and Axis II Disorders (SCID II). Clin Psychol Psychother. 2010; 18:75–9. 50. Fitzgerald DA, Arnold JF, Becker ES, Speckens AE, Rinck M, Rijpkema M, et al. How mood challenges emotional memory formation: an fMRI investigation. Neuroimage, 2011; 56:1783–90. https://doi.org/10. 1016/j.neuroimage.2011.02.061 PMID: 21371560 51. Langner O, Dotsch R, Bijlstra G, Wigboldus DHJ, Hawk ST, van Knippenberg A. Presentation and vali- dation of the Radboud Faces Database. Cogn Emot. 2010; 24:1377–88. 52. Reinecke A, Becker ES, Rinck M. Three indirect tasks assessing implicit threat associations and behav- ioral response tendencies: Test-retest reliability and validity. J Psychol. 2010; 218:4–11. 53. Brugha TS, Cragg D. The list of threatening experiences: the reliability and validity of a brief life events questionnaire. Acta Psychiatr Scand. 1990; 82:77–81. PMID: 2399824 54. Watson DE, Li B. TaqMan applications in genetic and molecular toxicology. Int J Toxicol. 2005; 24:139–145. https://doi.org/10.1080/10915810590948299 PMID: 16040565 55. Aguilera M, Arias B, Wichers M, Barrantes-Vidal J, Moya H, Villa H, et al. Early adversity and 5-HTT/ BDNF genes: new evidence of gene-environment interactions on depressive symptoms in a general population. Psychol Med. 2009; 39:1425–32. https://doi.org/10.1017/S0033291709005248 PMID: 19215635 56. Hu X, Oroszi G, Chun J, Smith TL, Goldman D, Schuckit MA. An expanded evaluation of the relation- ship of four alleles to the level of response to alcohol and the alcoholism risk. Alcohol Clin Exp Res. 2005; 29:8–16. PMID: 15654286 57. Zalsman G, Huang Y, Oquendo M, Burke A, Hu X, Brent D, et al. Association of a triallelic serotonin transporter gene promoter region (5-HTTLPR) polymorphism with stressful life events and severity of depression. Am J Psychiatry, 2006; 163:1588–93. https://doi.org/10.1176/ajp.2006.163.9.1588 PMID: 16946185 58. Beck AT, Steer RA, Brown GK. Manual for the Beck Depression Inventory-II. San Antonio, TX: Psy- chological Corporation;1996. 59. Van der Does AJW. Manual of the Dutch version of the BDI. 2nd ed. Lisse, NL: Harcourt Test Publish- ers; 2002. Dutch. 60. Wang Y-P., & Gorenstein C. (2013). Psychometric properties of the Beck Depression Inventory-II: a comprehensive review. Revista Brasileira Psiquiatria, 35, 416–431. 61. Liebowitz MR. Social phobia. Mod Probl of Pharmacopsychiatry. 1987; 22:141–73. 62. Heimberg RG, Horner KJ, Juster HR, Safren SA, Brown EJ, Schneier FR, et al. Psychometric properties of the Liebowitz Social Anxiety Scale. Psychol Med. 1999; 1:199–212. 63. Zisook S, Lesser I, Stewart JW, Wisniewski SR, Balasubramani GK, Fava M, et al. Effect of age at onset on the course of major depressive disorder. American Journal of Psychiatry. 2007; 164:1539–46. https://doi.org/10.1176/appi.ajp.2007.06101757 PMID: 17898345 64. Spijker J, de Graaf R, Bijl RV, Beekman AT, Ormel J, Nolen WA. Determinants of persistence of major depressive episodes in the general population. Results from the Netherlands Mental Health Survey and Incidence Study (NEMESIS). J Affect Disord. 2004; 81:231–240. https://doi.org/10.1016/j.jad.2003.08. 005 PMID: 15337327 65. Stein MB, Campbell-Sills L, Gelernter J. Genetic variation in 5-HTTLPR is associated with emotional resilience. Am J Med Genet B Neuropsychiatr Genet. 2009;150b:900–6. 66. Van Ijzendoorn MH, Belsky J, Bakermans-Kranenburg MJ. Serotonin transporter genotype 5HTTLPR as a marker of differential susceptibility? A meta-analysis of child and adolescent gene-by-environment studies. Transl Psychiatry, 2012;2. 67. Beck AT, Bredemeijer K. A unified model of depression: integrating clinical, cognitive, biological, and evolutionary perspectives. Clin Psychol Sci. 2016; 4:596–619. 68. De Raedt R, Koster E. Understanding vulnerability for depression from a cognitive neuroscience per- spective: a reappraisal of attentional factors and a new conceptual framework. Cogn Affect Behav Neu- rosci. 2010; 10:50–70. https://doi.org/10.3758/CABN.10.1.50 PMID: 20233955 69. Peeters F. Toward personalized treatment in psychiatry. J Clin Psychiatry. 2015; 76:e1313–14. https:// doi.org/10.4088/JCP.14com09737 PMID: 26528655 70. Uher R. Genes, environment, and individual differences in responding to treatment for depression. Harv Rev Psychiatry. 2011; 19:109–24. https://doi.org/10.3109/10673229.2011.586551 PMID: 21631158 71. Hayes SC, Levin ME, Plumb-Vilardaga J, Villatte JL, Pistorello J. Acceptance and commitment therapy and contextual behavioral science: examining the progress of a distinctive model of behavioral and PLOS ONE | https://doi.org/10.1371/journal.pone.0193787 March 16, 2018 12 / 13 Depression and associations between 5-HTTLPR, childhood trauma and approach avoidance tendencies cognitive therapy. Behav Ther. 2013; 44:180–8. https://doi.org/10.1016/j.beth.2009.08.002 PMID: 23611068 72. Becker ES, Ferentzi H, Ferrari G, Möbius M, Brugman S, Custers J, et al. Always approach the bright side of life: a general positivity training reduces stress vulnerability in vulnerable individuals. Cogn Ther Res. 2016; 40:57–71. 73. Browning M, Blackwell SE, Holmes EA. The use of cognitive bias modification and imagery in the under- standing and treatment of depression. Curr Top Behav Neurosci. 2013; 14:243–60. https://doi.org/10. 1007/7854_2012_212 PMID: 22566082 74. Fox E, Zougkou K, Ridgewell A, Garner K. The serotonin transporter gene alters sensitivity to attention bias modification: evidence for a plasticity gene. Biol Psychiatry. 2011; 70:1049–54. https://doi.org/10. 1016/j.biopsych.2011.07.004 PMID: 21840502 75. Faul F, Erdfelder E, Buchner A, Lang A-G. Statistical power analyses using G*Power 3.1: tests for cor- relation and regression analyses. Behav Res Methods. 2009; 41:1149–1160. https://doi.org/10.3758/ BRM.41.4.1149 PMID: 19897823 76. Lewinsohn PM, Steinmetz JL, Larson DW, & Franklin J. Depression-related cognitions: antecedent or consequence? J Abnorm Psychology, 1981; 90:213–19. 77. Brewin CR, Andrews B, Gotlib I.H. Psychopathology and early experience: a reappraisal of retrospec- tive reports. Psychol Bull. 1993; 113:82–98. PMID: 8426875 78. Hovens JG, Wiersma JE, Giltay EJ, van Oppen P, Spinhoven P, Penninx BW, et al. Childhood life events and childhood trauma in adult patients with depressive, anxiety and comorbid disorders vs. con- trols. Acta Psychiatr Scand. 2010; 122:66–74. https://doi.org/10.1111/j.1600-0447.2009.01491.x PMID: 19878136 PLOS ONE | https://doi.org/10.1371/journal.pone.0193787 March 16, 2018 13 / 13